Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein-1 (KLK1)
LigandBDBM50147088
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302558
Ki 265±n/a nM
Citation Bruncko MMcClellan WJWendt MDSauer DRGeyer ADalton CRKaminski MAWeitzberg MGong JDellaria JFMantei RZhao XNienaber VLStewart KKlinghofer VBouska JRockway TWGiranda VL Naphthamidine urokinase plasminogen activator inhibitors with improved pharmacokinetic properties. Bioorg Med Chem Lett 15:93-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kallikrein-1 (KLK1)
Name:Kallikrein 1
Synonyms:Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein
Type:Enzyme
Mol. Mass.:28874.69
Organism:Homo sapiens (Human)
Description:P06870
Residue:262
Sequence:
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50147088
n/a
NameBDBM50147088
Synonyms:6-Carbamimidoyl-4-furan-3-yl-naphthalene-2-carboxylic acid phenylamide | CHEMBL319047
TypeSmall organic molecule
Emp. Form.C22H17N3O2
Mol. Mass.355.3893
SMILESNC(=N)c1ccc2cc(cc(-c3ccoc3)c2c1)C(=O)Nc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: