| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50157217 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_305393 (CHEMBL833043) |
|---|
| IC50 | 50000±n/a nM |
|---|
| Citation |  Garino, C; Bihel, F; Pietrancosta, N; Laras, Y; Quéléver, G; Woo, I; Klein, P; Bain, J; Boucher, JL; Kraus, JL New 2-bromomethyl-8-substituted-benzo[c]chromen-6-ones. Synthesis and biological properties. Bioorg Med Chem Lett15:135-8 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50157217 |
|---|
| n/a |
|---|
| Name | BDBM50157217 |
|---|
| Synonyms: | 2-Methyl-8-nitro-benzo[c]chromen-6-one | CHEMBL182831 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H9NO4 |
|---|
| Mol. Mass. | 255.2256 |
|---|
| SMILES | Cc1ccc2oc(=O)c3cc(ccc3c2c1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
