Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBDKRB1
LigandBDBM50157515
Substrate/Competitorn/a
Meas. Tech.ChEMBL_429981
Ki 35.3±n/a nM
Citation Kuduk SDNg CFeng DMWai JMChang RSHarrell CMMurphy KLRansom RWReiss DIvarsson MMason GBoyce STang CPrueksaritanont TFreidinger RMPettibone DJBock MG 2,3-diaminopyridine bradykinin B1 receptor antagonists. J Med Chem 47:6439-42 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BDKRB1
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1R | BK-1 receptor | KB1 | Kinin B1 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:38389.97
Organism:RAT
Description:B1 BRADYKININ BDKRB1 RAT::P97583
Residue:337
Sequence:
MASEVLLELQPSNRSLQAPANITSCESALEDWDLLYRVLPGFVITICFFGLLGNLLVLSF
FLLPWRQWWWQQRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIGNRFNWPFGTDLC
RVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSI
PTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILASLR
GQKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEIT
DLGLQLANFFAFVNSCLNPLIYVFAGRLLKTRVLGTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157515
n/a
NameBDBM50157515
Synonyms:4'-{(R)-1-[4-chloro-3-(2-cyano-acetylamino)-pyridin-2-ylamino]-ethyl}-3-fluoro-biphenyl-2-carboxylic acid methyl ester | CHEMBL225607
TypeSmall organic molecule
Emp. Form.C24H20ClFN4O3
Mol. Mass.466.892
SMILESCOC(=O)c1c(F)cccc1-c1ccc(cc1)[C@@H](C)Nc1nccc(Cl)c1NC(=O)CC#N |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: