| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50157684 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_430084 (CHEMBL918105) |
|---|
| IC50 | >1000±n/a nM |
|---|
| Citation |  Balboni, G; Salvadori, S; Dal Piaz, A; Bortolotti, F; Argazzi, R; Negri, L; Lattanzi, R; Bryant, SD; Jinsmaa, Y; Lazarus, LH Highly selective fluorescent analogue of the potent delta-opioid receptor antagonist Dmt-Tic. J Med Chem47:6541-6 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50157684 |
|---|
| n/a |
|---|
| Name | BDBM50157684 |
|---|
| Synonyms: | CHEMBL2369958 | H-Dmt-Tic-Glu-NH2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H32N4O6 |
|---|
| Mol. Mass. | 496.5555 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2C[C@H]1C(=O)N[C@@H](CCC(O)=O)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
