Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase (TEM-1)
LigandBDBM50157693
Substrate/Competitorn/a
Meas. Tech.ChEMBL_430085
IC50 6±n/a nM
Citation Venkatesan AMGu YDos Santos OAbe TAgarwal AYang YPetersen PJWeiss WJMansour TSNukaga MHujer AMBonomo RAKnox JR Structure-activity relationship of 6-methylidene penems bearing tricyclic heterocycles as broad-spectrum beta-lactamase inhibitors: crystallographic structures show unexpected binding of 1,4-thiazepine intermediates. J Med Chem 47:6556-68 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase (TEM-1)
Name:Bacterial beta-lactamase TEM
Synonyms:Bacterial beta-lactamase TEM | Beta-lactamase TEM | Beta-lactamase TEM-1 | Beta-lactamase TEM-1b | Beta-lactamase TEM1D | Beta-lactamase TEM1E | Beta-lactamase TEM1F | TEM beta lactamase | TEM extended-spectrum beta-lactamase | TEM-1 beta-lactamase
Type:Enzyme
Mol. Mass.:31512.33
Organism:Escherichia coli
Description:P62593
Residue:286
Sequence:
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157693
n/a
NameBDBM50157693
Synonyms:(5R,6Z)-6-[(7-chloroimidazo[2,1-b][1,3]-benzothiazol-2-ylmethylene)-7-oxo-4-thia-1-azabicyclo-[3.2.0]hept-2-ene-2-carboxylic acid sodium | CHEMBL388778
TypeSmall organic molecule
Emp. Form.C16H7ClN3NaO3S2
Mol. Mass.411.818
SMILES[Na]OC(=O)C1=CS[C@H]2N1C(=O)\C2=C\c1cn2c(n1)sc1cc(Cl)ccc21 |r,t:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: