Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Hydroxytryptamine receptor 7 (5-HT7)
LigandBDBM21367
Substrate/Competitorn/a
Meas. Tech.ChEMBL_430137
EC50 2560±n/a nM
Citation Leopoldo MBerardi FColabufo NAContino MLacivita ENiso MPerrone RTortorella V Structure-affinity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinealkylamides, a new class of 5-hydroxytryptamine7 receptor agents. J Med Chem 47:6616-24 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-Hydroxytryptamine receptor 7 (5-HT7)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-HT7L | 5-HT7S | 5-HT7b | 5-hydroxytryptamine receptor 7 | 5HT7 | HTR7
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:53573.08
Organism:Homo sapiens (Human)
Description:P34969
Residue:479
Sequence:
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21367
n/a
NameBDBM21367
Synonyms:6-{4-[2-(methylsulfanyl)phenyl]piperazin-1-yl}-N-(1,2,3,4-tetrahydronaphthalen-1-yl)hexanamide | CHEMBL225284 | LP-44 | Piperazinehexanamide derivative, 5
TypeSmall organic molecule
Emp. Form.C27H37N3OS
Mol. Mass.451.667
SMILESCSc1ccccc1N1CCN(CCCCCC(=O)NC2CCCc3ccccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: