Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFlap endonuclease 1
LigandBDBM50157830
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304960
IC50 0.012±n/a nM
Citation Tumey LNBom DHuck BGleason EWang JSilver DBrunden KBoozer SRundlett SSherf BMurphy SDent TLeventhal CBailey AHarrington JBennani YL The identification and optimization of a N-hydroxy urea series of flap endonuclease 1 inhibitors. Bioorg Med Chem Lett 15:277-81 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Flap endonuclease 1
Name:Flap endonuclease 1
Synonyms:DNase IV | FEN-1 | FEN1 | Flap structure-specific endonuclease 1 | MF1 | Maturation factor 1 | RAD2 | hFEN-1
Type:PROTEIN
Mol. Mass.:42602.57
Organism:Homo sapiens (Human)
Description:ChEMBL_1517026
Residue:380
Sequence:
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGSTKKKAKTGAAGKFKRGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157830
n/a
NameBDBM50157830
Synonyms:3-Hydroxy-7-phenyl-1H-thieno[3,2-d]pyrimidine-2,4-dione | CHEMBL361011
TypeSmall organic molecule
Emp. Form.C12H8N2O3S
Mol. Mass.260.269
SMILESOn1c(=O)[nH]c2c(csc2c1=O)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: