Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen Phosphorylase (PYGL)
LigandBDBM50158279
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304931
IC50 290±n/a nM
Citation Wright SWRath VLGenereux PEHageman DLLevy CBMcClure LDMcCoid SCMcPherson RKSchelhorn TMWilder DEZavadoski WJGibbs EMTreadway JL 5-Chloroindoloyl glycine amide inhibitors of glycogen phosphorylase: synthesis, in vitro, in vivo, and X-ray crystallographic characterization. Bioorg Med Chem Lett 15:459-65 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycogen Phosphorylase (PYGL)
Name:Liver glycogen phosphorylase
Synonyms:Glycogen Phosphorylase, liver form
Type:Homodimer
Mol. Mass.:97153.98
Organism:Homo sapiens (Human)
Description:Dimers associate into a tetramer to form the enzymatically active phosphorylase A.
Residue:847
Sequence:
MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDI
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEA
DDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQ
ENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFV
PRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE
SNKVNGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158279
n/a
NameBDBM50158279
Synonyms:5-Chloro-1H-indole-2-carboxylic acid {[tert-butyl-(2-hydroxy-ethyl)-carbamoyl]-methyl}-amide | CHEMBL360993
TypeSmall organic molecule
Emp. Form.C17H22ClN3O3
Mol. Mass.351.828
SMILESCC(C)(C)N(CCO)C(=O)CNC(=O)c1cc2cc(Cl)ccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: