| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 5 |
|---|
| Ligand | BDBM50158351 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_430297 (CHEMBL913923) |
|---|
| IC50 | 21±n/a nM |
|---|
| Citation |  Hale, JJ; Lynch, CL; Neway, W; Mills, SG; Hajdu, R; Keohane, CA; Rosenbach, MJ; Milligan, JA; Shei, GJ; Parent, SA; Chrebet, G; Bergstrom, J; Card, D; Ferrer, M; Hodder, P; Strulovici, B; Rosen, H; Mandala, S A rational utilization of high-throughput screening affords selective, orally bioavailable 1-benzyl-3-carboxyazetidine sphingosine-1-phosphate-1 receptor agonists. J Med Chem47:6662-5 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 5 |
|---|
| Name: | Sphingosine 1-phosphate receptor 5 |
|---|
| Synonyms: | EDG8 | Endothelial differentiation sphingolipid G-protein-coupled receptor 8 | S1P5 | S1PR5 | S1PR5_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-8 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41796.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 398 |
|---|
| Sequence: | MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
|
|
|
|---|
| BDBM50158351 |
|---|
| n/a |
|---|
| Name | BDBM50158351 |
|---|
| Synonyms: | 26-tert-butyl-13-(2,4,4-trimethylpentan-2-yl)-3,6,9,16,19,22-hexaoxatricyclo[22.3.1.0^{10,15}]octacosa-1(28),10(15),11,13,24,26-hexaene-28-carboxylic acid | CHEMBL224549 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H19F6NO3S |
|---|
| Mol. Mass. | 515.468 |
|---|
| SMILES | OC(=O)C1CN(Cc2ccc(OCc3cc(c(s3)C(F)(F)F)-c3ccccc3)c(c2)C(F)(F)F)C1 |
|---|
| Structure | 
|
|---|
Search and Browse
