| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50159099 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303755 (CHEMBL829798) |
|---|
| Ki | 98.766±n/a nM |
|---|
| Citation |  Trapani, G; Laquintana, V; Denora, N; Trapani, A; Lopedota, A; Latrofa, A; Franco, M; Serra, M; Pisu, MG; Floris, I; Sanna, E; Biggio, G; Liso, G Structure-activity relationships and effects on neuroactive steroid synthesis in a series of 2-phenylimidazo[1,2-a]pyridineacetamide peripheral benzodiazepine receptors ligands. J Med Chem48:292-305 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50159099 |
|---|
| n/a |
|---|
| Name | BDBM50159099 |
|---|
| Synonyms: | CHEMBL362200 | N-Benzyl-2-[6,8-dichloro-2-(4-chloro-phenyl)-imidazo[1,2-a]pyridin-3-yl]-acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H16Cl3N3O |
|---|
| Mol. Mass. | 444.741 |
|---|
| SMILES | Clc1ccc(cc1)-c1nc2c(Cl)cc(Cl)cn2c1CC(=O)NCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
