| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50160100 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_305570 (CHEMBL827164) |
|---|
| IC50 | 520±n/a nM |
|---|
| Citation |  Meurer, LC; Finke, PE; Mills, SG; Walsh, TF; Toupence, RB; Debenham, JS; Goulet, MT; Wang, J; Tong, X; Fong, TM; Lao, J; Schaeffer, MT; Chen, J; Shen, CP; Sloan Stribling, D; Shearman, LP; Strack, AM; Van der Ploeg, LH Synthesis and SAR of 5,6-diarylpyridines as human CB1 inverse agonists. Bioorg Med Chem Lett15:645-51 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50160100 |
|---|
| n/a |
|---|
| Name | BDBM50160100 |
|---|
| Synonyms: | 2-(3,4-difluorobenzyloxy)-5-(4-chlorophenyl)-6-(2,4-dichlorophenyl)nicotinonitrile | 5-(4-Chloro-phenyl)-6-(2,4-dichloro-phenyl)-2-(3,4-difluoro-benzyloxy)-nicotinonitrile | CHEMBL367819 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H13Cl3F2N2O |
|---|
| Mol. Mass. | 501.739 |
|---|
| SMILES | Fc1ccc(COc2nc(-c3ccc(Cl)cc3Cl)c(cc2C#N)-c2ccc(Cl)cc2)cc1F |
|---|
| Structure | 
|
|---|
Search and Browse
