Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOpioid receptors; mu/kappa/delta
LigandBDBM50160833
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303046
Ki 2.9±n/a nM
Citation Kumar VGuo DCassel JADaubert JDDehaven RNDehaven-Hudkins DLGauntner EKGottshall SLGreiner SLKoblish MLittle PJMansson EMaycock AL Synthesis and evaluation of novel peripherally restricted kappa-opioid receptor agonists. Bioorg Med Chem Lett 15:1091-5 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Opioid receptors; mu/kappa/delta
Name:Opioid receptors; mu/kappa/delta
Synonyms:K-OR-1 | KOR-1 | Kappa-opioid receptor (KOR) | Kappa-type opioid receptor (KOPR) | Kappa-type opioid receptor (KOR) | Kappa-type opioid receptor (Kappa) | OPIATE Kappa | OPRK | OPRK1 | kappa opioid receptor (KOR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42648.76
Organism:Homo sapiens (Human)
Description:P41145
Residue:380
Sequence:
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50160833
n/a
NameBDBM50160833
Synonyms:CHEMBL360678 | [3-(1-{Methyl-[2-(4-trifluoromethyl-phenyl)-acetyl]-amino}-2-pyrrolidin-1-yl-ethyl)-phenoxy]-acetic acid tert-butyl ester
TypeSmall organic molecule
Emp. Form.C28H35F3N2O4
Mol. Mass.520.5837
SMILESCN(C(CN1CCCC1)c1cccc(OCC(=O)OC(C)(C)C)c1)C(=O)Cc1ccc(cc1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: