Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid TP receptor
LigandBDBM50160918
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302705
Ki>21000±n/a nM
Citation Ducharme YBlouin MCarrière MCChateauneuf ACôté BDenis DFrenette RGreig GKargman SLamontagne SMartins ENantel FO'Neill GSawyer NMetters KMFriesen RW 2,3-Diarylthiophenes as selective EP1 receptor antagonists. Bioorg Med Chem Lett 15:1155-60 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid TP receptor
Name:Thromboxane A2 receptor
Synonyms:TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta
Type:Enyzme
Mol. Mass.:37445.28
Organism:Homo sapiens (Human)
Description:P21731
Residue:343
Sequence:
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50160918
n/a
NameBDBM50160918
Synonyms:CHEMBL182662 | N-{3-[3-(2-Benzyloxy-5-chloro-phenyl)-thiophen-2-yl]-phenyl}-C-phenyl-methanesulfonamide
TypeSmall organic molecule
Emp. Form.C30H24ClNO3S2
Mol. Mass.546.099
SMILESClc1ccc(OCc2ccccc2)c(c1)-c1ccsc1-c1cccc(NS(=O)(=O)Cc2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: