Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP1 subtype (EP1)
LigandBDBM50160910
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303322
Ki 220±n/a nM
Citation Ducharme YBlouin MCarrière MCChateauneuf ACôté BDenis DFrenette RGreig GKargman SLamontagne SMartins ENantel FO'Neill GSawyer NMetters KMFriesen RW 2,3-Diarylthiophenes as selective EP1 receptor antagonists. Bioorg Med Chem Lett 15:1155-60 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP1 subtype (EP1)
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor, EP1 subtype | Prostaglandin E2 receptor EP1 subtype | Prostanoid EP1 receptor
Type:Enzyme
Mol. Mass.:41834.57
Organism:Homo sapiens (Human)
Description:P34995
Residue:402
Sequence:
MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50160910
n/a
NameBDBM50160910
Synonyms:CHEMBL184779 | {3-[3-(2-Benzyloxy-5-chloro-phenyl)-thiophen-2-yl]-phenyl}-acetic acid
TypeSmall organic molecule
Emp. Form.C25H19ClO3S
Mol. Mass.434.935
SMILESOC(=O)Cc1cccc(c1)-c1sccc1-c1cc(Cl)ccc1OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: