Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(4) dopamine receptor
LigandBDBM50119377
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302368
Ki 30±n/a nM
Citation Boeckler FLanig HGmeiner P Modeling the similarity and divergence of dopamine D2-like receptors and identification of validated ligand-receptor complexes. J Med Chem 48:694-709 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(4) dopamine receptor
Name:D(4) dopamine receptor
Synonyms:D(2C) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50119377
n/a
NameBDBM50119377
Synonyms:Benzofuran-2-carboxylic acid {4-[4-(2-methoxy-phenyl)-piperazin-1-yl]-butyl}-amide | CHEMBL124444 | N-(4-(4-(2-methoxyphenyl)piperazin-1-yl)butyl)benzofuran-2-carboxamide
TypeSmall organic molecule
Emp. Form.C24H29N3O3
Mol. Mass.407.5054
SMILESCOc1ccccc1N1CCN(CCCCNC(=O)c2cc3ccccc3o2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: