Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase 38-like
LigandBDBM50024294
Substrate/Competitorn/a
Meas. Tech.ChEMBL_325118
Kd 2300±n/a nM
Citation Fabian MABiggs WHTreiber DKAtteridge CEAzimioara MDBenedetti MGCarter TACiceri PEdeen PTFloyd MFord JMGalvin MGerlach JLGrotzfeld RMHerrgard SInsko DEInsko MALai AGLélias JMMehta SAMilanov ZVVelasco AMWodicka LMPatel HKZarrinkar PPLockhart DJ A small molecule-kinase interaction map for clinical kinase inhibitors. Nat Biotechnol 23:329-36 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase 38-like
Name:Serine/threonine-protein kinase 38-like
Synonyms:NDR2
Type:PROTEIN
Mol. Mass.:54004.24
Organism:Homo sapiens (Human)
Description:ChEMBL_587191
Residue:464
Sequence:
MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLAD
EEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKI
LRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLM
KKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKK
AHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGY
NKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILR
FCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL
QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50024294
n/a
NameBDBM50024294
Synonyms:SP-600125
TypeSmall organic molecule
Emp. Form.C14H8N2O
Mol. Mass.220.2261
SMILESOc1c2cccc3N=Nc(c23)c2ccccc12 |c:7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: