Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphorylase kinase
LigandBDBM21
Substrate/Competitorn/a
Meas. Tech.ChEMBL_325059
Kd 9500±n/a nM
Citation Fabian MABiggs WHTreiber DKAtteridge CEAzimioara MDBenedetti MGCarter TACiceri PEdeen PTFloyd MFord JMGalvin MGerlach JLGrotzfeld RMHerrgard SInsko DEInsko MALai AGLélias JMMehta SAMilanov ZVVelasco AMWodicka LMPatel HKZarrinkar PPLockhart DJ A small molecule-kinase interaction map for clinical kinase inhibitors. Nat Biotechnol 23:329-36 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphorylase kinase
Name:Phosphorylase kinase
Synonyms:PHKG2 | Phosphorylase kinase gamma subunit 2
Type:PROTEIN
Mol. Mass.:46440.15
Organism:Homo sapiens (Human)
Description:ChEMBL_774277
Residue:406
Sequence:
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAE
RLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLT
EKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEP
GEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQIL
MLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW
NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLYGH
WVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21
n/a
NameBDBM21
Synonyms:6-[(4R,5S,6S,7R)-4,7-dibenzyl-3-(5-carboxypentyl)-5,6-dihydroxy-2-oxo-1,3-diazepan-1-yl]hexanoic acid | CHEMBL24828 | DMPC Cyclic Urea 1 | N-(4-bromo-2-fluorophenyl)-6-methoxy-7-[(1-methylpiperidin-4-yl)methoxy]quinazolin-4-amine | VANDETANIB | ZD-6474 | ZD6474 | cid_3081361
Typen/a
Emp. Form.C22H24BrFN4O2
Mol. Mass.475.354
SMILESCOc1cc2c(Nc3ccc(Br)cc3F)ncnc2cc1OCC1CCN(C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: