| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-C chemokine receptor type 3 |
|---|
| Ligand | BDBM50161407 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302656 (CHEMBL839945) |
|---|
| Ki | 2981±n/a nM |
|---|
| Citation |  Ting, PC; Lee, JF; Wu, J; Umland, SP; Aslanian, R; Cao, J; Dong, Y; Garlisi, CG; Gilbert, EJ; Huang, Y; Jakway, J; Kelly, J; Liu, Z; McCombie, S; Shah, H; Tian, F; Wan, Y; Shih, NY The synthesis of substituted bipiperidine amide compounds as CCR3 antagonists. Bioorg Med Chem Lett15:1375-8 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-C chemokine receptor type 3 |
|---|
| Name: | C-C chemokine receptor type 3 |
|---|
| Synonyms: | CCR3_RAT | Ccr3 | Cmkbr3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 41648.91 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1445730 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MASNEEELKTVVETFETTPYEYEWAPPCEKVSIRELGSWLLPPLYSLVFIVGLLGNMMVV
LILIKYRKLQIMTNIYLLNLAISDLLFLFTVPFWIHYVLWNEWGFGHCMCKMLSGLYYLA
LYSEIFFIILLTIDRYLAIVHAVLALRARTVTFATITSIITWGFAVLAALPEFIFHESQD
NFGDLSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVICYSGIIKTLLRCPNKKKHK
AIQLIFVVMIVFFIFWTPYNLVLLLSAFHSTFLETSCQQSIHLDLAMQVTEVITHTHCCI
NPIIYAFVGERFRKHLRLFFHRNVAIYLRKYISFLPGEKLERTSSVSPSTGEQEISVVF
|
|
|
|---|
| BDBM50161407 |
|---|
| n/a |
|---|
| Name | BDBM50161407 |
|---|
| Synonyms: | CHEMBL178447 | [(3S,4S)-4-(3,4-Dichloro-benzyl)-3-hydroxymethyl-[1,4'']bipiperidinyl-1''-yl]-quinolin-6-yl-methanone |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H31Cl2N3O2 |
|---|
| Mol. Mass. | 512.471 |
|---|
| SMILES | OC[C@@H]1CN(CC[C@@H]1Cc1ccc(Cl)c(Cl)c1)C1CCN(CC1)C(=O)c1ccc2ncccc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
