Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 3
LigandBDBM50161407
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303259
Ki 3.3±n/a nM
Citation Ting PCLee JFWu JUmland SPAslanian RCao JDong YGarlisi CGGilbert EJHuang YJakway JKelly JLiu ZMcCombie SShah HTian FWan YShih NY The synthesis of substituted bipiperidine amide compounds as CCR3 antagonists. Bioorg Med Chem Lett 15:1375-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 3
Name:C-C chemokine receptor type 3
Synonyms:C-C CKR-3 | C-C chemokine receptor type 3 (CCR3) | CC-CKR-3 | CCR-3 | CCR3 | CD_antigen=CD193 | CKR3 | Eosinophil eotaxin receptor
Type:Enzyme
Mol. Mass.:41053.88
Organism:Homo sapiens (Human)
Description:P51677
Residue:355
Sequence:
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50161407
n/a
NameBDBM50161407
Synonyms:CHEMBL178447 | [(3S,4S)-4-(3,4-Dichloro-benzyl)-3-hydroxymethyl-[1,4'']bipiperidinyl-1''-yl]-quinolin-6-yl-methanone
TypeSmall organic molecule
Emp. Form.C28H31Cl2N3O2
Mol. Mass.512.471
SMILESOC[C@@H]1CN(CC[C@@H]1Cc1ccc(Cl)c(Cl)c1)C1CCN(CC1)C(=O)c1ccc2ncccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: