Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnandamide amidohydrolase
LigandBDBM50161525
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303730
Ki 0.52±n/a nM
Citation Leung DDu WHardouin CCheng HHwang ICravatt BFBoger DL Discovery of an exceptionally potent and selective class of fatty acid amide hydrolase inhibitors enlisting proteome-wide selectivity screening: concurrent optimization of enzyme inhibitor potency and selectivity. Bioorg Med Chem Lett 15:1423-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Anandamide amidohydrolase
Name:Anandamide amidohydrolase
Synonyms:Anandamide amidohydrolase 1 | Fatty Acid Amide Hydrolase | Fatty-acid amide hydrolase (FAAH) | Fatty-acid amide hydrolase 1 | Oleamide hydrolase 1
Type:Hydrolase; single-pass membrane protein; homodimer
Mol. Mass.:63227.28
Organism:Mus musculus (mouse)
Description:Mouse brain membranes were used in the assay.
Residue:579
Sequence:
MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRARQKQRAGLETMDKAVQ
RFRLQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVTSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVGPMARDVDSLALCMKALLCE
DLFRLDSTIPPLPFREEIYRSSRPLRVGYYETDNYTMPTPAMRRAVMETKQSLEAAGHTL
VPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDPCLGDLVLVLKLPRWFKKLLSF
LLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSVIAQWKAMNLDVVLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMEHYKGYFGDMWDNILKKGMK
KGIGLPVAVQCVALPWQEELCLRFMREVERLMTPEKRPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50161525
n/a
NameBDBM50161525
Synonyms:1-(oxazolo[4,5-b]pyridin-2-yl)-9-phenylnonan-1-one | 1-Oxazolo[4,5-b]pyridin-2-yl-9-phenyl-nonan-1-one | CHEMBL182199
TypeSmall organic molecule
Emp. Form.C21H24N2O2
Mol. Mass.336.4275
SMILESO=C(CCCCCCCCc1ccccc1)c1nc2ncccc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: