Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid DP receptor
LigandBDBM50161746
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303004
IC50>10000±n/a nM
Citation Ulven TKostenis E Minor structural modifications convert the dual TP/CRTH2 antagonist ramatroban into a highly selective and potent CRTH2 antagonist. J Med Chem 48:897-900 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid DP receptor
Name:Prostanoid DP receptor
Synonyms:Prostaglandin D2 | Prostaglandin D2 receptor
Type:Enzyme
Mol. Mass.:40288.87
Organism:Homo sapiens (Human)
Description:Q13258
Residue:359
Sequence:
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50161746
n/a
NameBDBM50161746
Synonyms:(R)-3-(3-(4-fluorophenylsulfonamido)-1,2,3,4-tetrahydrocarbazol-9-yl)propanoic acid | 3-[(R)-3-(4-Fluoro-benzenesulfonylamino)-1,2,3,4-tetrahydro-carbazol-9-yl]-propionic acid | CHEMBL361812 | RAMATROBAN
TypeSmall organic molecule
Emp. Form.C21H21FN2O4S
Mol. Mass.416.466
SMILESOC(=O)CCn1c2CC[C@H](Cc2c2ccccc12)NS(=O)(=O)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: