Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-coupled receptor 44
LigandBDBM50162896
Substrate/Competitorn/a
Meas. Tech.ChEMBL_308693
Ki 150±n/a nM
Citation Robarge MJBom DCTumey LNVarga NGleason ESilver DSong JMurphy SMEkema GDoucette CHanniford DPalmer MPawlowski GDanzig JLoftus MHunady KSherf BAMays RWStricker-Krongrad ABrunden KRHarrington JJBennani YL Isosteric ramatroban analogs: selective and potent CRTH-2 antagonists. Bioorg Med Chem Lett 15:1749-53 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-coupled receptor 44
Name:G protein-coupled receptor 44
Synonyms:CD_antigen=CD294 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | G-protein coupled receptor 44 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2)
Type:Enzyme
Mol. Mass.:43295.45
Organism:Homo sapiens (Human)
Description:Q9Y5Y4
Residue:395
Sequence:
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50162896
n/a
NameBDBM50162896
Synonyms:CHEMBL369330 | [3-tert-Butyl-6-(4-fluoro-benzenesulfonylamino)-1,2,3,4-tetrahydro-carbazol-9-yl]-acetic acid
TypeSmall organic molecule
Emp. Form.C24H27FN2O4S
Mol. Mass.458.546
SMILESCC(C)(C)C1CCc2c(C1)c1cc(NS(=O)(=O)c3ccc(F)cc3)ccc1n2CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: