Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid TP receptor
LigandBDBM50162897
Substrate/Competitorn/a
Meas. Tech.ChEMBL_308679
Ki 1500±n/a nM
Citation Robarge MJBom DCTumey LNVarga NGleason ESilver DSong JMurphy SMEkema GDoucette CHanniford DPalmer MPawlowski GDanzig JLoftus MHunady KSherf BAMays RWStricker-Krongrad ABrunden KRHarrington JJBennani YL Isosteric ramatroban analogs: selective and potent CRTH-2 antagonists. Bioorg Med Chem Lett 15:1749-53 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid TP receptor
Name:Thromboxane A2 receptor
Synonyms:TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta
Type:Enyzme
Mol. Mass.:37445.28
Organism:Homo sapiens (Human)
Description:P21731
Residue:343
Sequence:
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50162897
n/a
NameBDBM50162897
Synonyms:3-[6-(4-Fluoro-benzenesulfonylamino)-1,2,3,4-tetrahydro-carbazol-9-yl]-propionic acid | CHEMBL180929
TypeSmall organic molecule
Emp. Form.C21H21FN2O4S
Mol. Mass.416.466
SMILESOC(=O)CCn1c2CCCCc2c2cc(NS(=O)(=O)c3ccc(F)cc3)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: