Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM50137981
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303035
Ki 0.43±n/a nM
Citation Campiani GButini SFattorusso CTrotta FGemma SCatalanotti BNacci VFiorini ICagnotto AMereghetti IMennini TMinetti PDi Cesare MAStasi MADi Serio SGhirardi OTinti OCarminati P Novel atypical antipsychotic agents: rational design, an efficient palladium-catalyzed route, and pharmacological studies. J Med Chem 48:1705-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50137981
n/a
NameBDBM50137981
Synonyms:7-Chloro-9-(4-methyl-piperazin-1-yl)-4-thia-10a-aza-benzo[f]azulene | CHEMBL426763
TypeSmall organic molecule
Emp. Form.C17H18ClN3S
Mol. Mass.331.863
SMILESCN1CCN(CC1)C1=Cn2cccc2Sc2ccc(Cl)cc12 |t:8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: