Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor protein alpha-2/beta-2 subunit
LigandBDBM50162985
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303167
Ki 61±n/a nM
Citation Wei ZLXiao YYuan HBaydyuk MPetukhov PAMusachio JLKellar KJKozikowski AP Novel pyridyl ring C5 substituted analogues of epibatidine and 3-(1-methyl-2(S)-pyrrolidinylmethoxy)pyridine (A-84543) as highly selective agents for neuronal nicotinic acetylcholine receptors containing beta2 subunits. J Med Chem 48:1721-4 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor protein alpha-2/beta-2 subunit
Name:Neuronal acetylcholine receptor protein alpha-2/beta-2 subunit
Synonyms:Neuronal acetylcholine receptor; alpha2/beta2 | Neuronal acetylcholine recetpor; alpha2/beta2
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 305724
Components:This complex has 2 components.
Component 1
Name:Neuronal acetylcholine receptor subunit alpha-2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:59759.69
Organism:Homo sapiens (Human)
Description:Cholinergic, Nicotinic Alpha2Beta2 0 HUMAN::Q15822
Residue:529
Sequence:
MGPSCPVFLSFTKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETED
RLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKL
RWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYK
SSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTY
NSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLC
ISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH
TMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEE
DRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHL
RSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Neuronal acetylcholine receptor subunit beta-2
Synonyms:Neuronal acetylcholine receptor protein beta-2 subunit | Nicotinic acetylcholine receptor alpha3/beta2/alpha5
Type:Protein
Mol. Mass.:57020.50
Organism:Homo sapiens (Human)
Description:P17787
Residue:502
Sequence:
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50162985
n/a
NameBDBM50162985
Synonyms:2-Methyl-4-[5-((S)-1-methyl-pyrrolidin-2-ylmethoxy)-pyridin-3-yl]-but-3-yn-2-ol | CHEMBL180525
TypeSmall organic molecule
Emp. Form.C16H22N2O2
Mol. Mass.274.3581
SMILESCN1CCC[C@H]1COc1cncc(c1)C#CC(C)(C)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: