| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50163391 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302211 (CHEMBL826984) |
|---|
| Kd | 0.400000±n/a nM |
|---|
| Citation |  Surleraux, DL; de Kock, HA; Verschueren, WG; Pille, GM; Maes, LJ; Peeters, A; Vendeville, S; De Meyer, S; Azijn, H; Pauwels, R; de Bethune, MP; King, NM; Prabu-Jeyabalan, M; Schiffer, CA; Wigerinck, PB Design of HIV-1 protease inhibitors active on multidrug-resistant virus. J Med Chem48:1965-73 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50163391 |
|---|
| n/a |
|---|
| Name | BDBM50163391 |
|---|
| Synonyms: | CHEMBL195725 | {3-[(4-Amino-benzenesulfonyl)-isobutyl-amino]-1-benzyl-2-hydroxy-propyl}-carbamic acid tetrahydro-furan-3-yl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H35N3O6S |
|---|
| Mol. Mass. | 505.627 |
|---|
| SMILES | CC(C)CN(CC(O)C(Cc1ccccc1)NC(=O)OC1CCOC1)S(=O)(=O)c1ccc(N)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
