Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 5
LigandBDBM50163636
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306390
IC50 1000±n/a nM
Citation De Lucca GVKim UTVargo BJDuncia JVSantella JBGardner DSZheng CLiauw AWang ZEmmett GWacker DAWelch PKCovington MStowell NCWadman EADas AMDavies PYeleswaram SGraden DMSolomon KANewton RCTrainor GLDecicco CPKo SS Discovery of CC chemokine receptor-3 (CCR3) antagonists with picomolar potency. J Med Chem 48:2194-211 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 5
Name:CCR5/mu opioid receptor complex
Synonyms:C-C CKR-5 | CC-CKR-5 | CCR-5 | CCR5/mu opioid receptor complex | CD_antigen=CD195 | CHEMR13 | HIV-1 fusion coreceptor
Type:Enzyme
Mol. Mass.:40540.21
Organism:Homo sapiens (Human)
Description:P51681
Residue:352
Sequence:
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50163636
n/a
NameBDBM50163636
Synonyms:1-((1R,2S)-2-(((S)-3-(4-fluorobenzyl)piperidin-1-yl)methyl)cyclohexyl)-3-(5-acetyl-4-methylthiazol-2-yl)urea | 1-(5-Acetyl-4-methyl-thiazol-2-yl)-3-{(1R,2S)-2-[(S)-3-(4-fluoro-benzyl)-piperidin-1-ylmethyl]-cyclohexyl}-urea | CHEMBL195433
TypeSmall organic molecule
Emp. Form.C26H35FN4O2S
Mol. Mass.486.645
SMILESCC(=O)c1sc(NC(=O)N[C@@H]2CCCC[C@H]2CN2CCC[C@@H](Cc3ccc(F)cc3)C2)nc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: