Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombin and coagulation factor X
LigandBDBM50164267
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302313
Ki 4.4±n/a nM
Citation Stauffer KJWilliams PDSelnick HGNantermet PGNewton CLHomnick CFZrada MMLewis SDLucas BJKrueger JAPietrak BLLyle EASingh RMiller-Stein CWhite RBWong BWallace AASitko GRCook JJHolahan MAStranieri-Michener MLeonard YMLynch JJMcMasters DRYan Y 9-hydroxyazafluorenes and their use in thrombin inhibitors. J Med Chem 48:2282-93 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombin and coagulation factor X
Name:Thrombin and coagulation factor X
Synonyms:Activation peptide fragment 1 | Activation peptide fragment 2 | Coagulation factor II | F2 | Prothrombin | Prothrombin precursor | Thrombin heavy chain | Thrombin light chain
Type:Protein
Mol. Mass.:70029.57
Organism:Homo sapiens (Human)
Description:P00734
Residue:622
Sequence:
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50164267
n/a
NameBDBM50164267
Synonyms:(S)-1-(9-Hydroxy-3-oxy-9H-3-aza-fluorene-9-carbonyl)-pyrrolidine-2-carboxylic acid 2-aminomethyl-5-chloro-benzylamide | CHEMBL190687
TypeSmall organic molecule
Emp. Form.C26H25ClN4O4
Mol. Mass.492.954
SMILESNCc1ccc(Cl)cc1CNC(=O)[C@@H]1CCCN1C(=O)C1(O)c2ccccc2-c2c[n+]([O-])ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: