| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50164260 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302454 (CHEMBL827150) |
|---|
| Ki | 300±n/a nM |
|---|
| Citation |  Stauffer, KJ; Williams, PD; Selnick, HG; Nantermet, PG; Newton, CL; Homnick, CF; Zrada, MM; Lewis, SD; Lucas, BJ; Krueger, JA; Pietrak, BL; Lyle, EA; Singh, R; Miller-Stein, C; White, RB; Wong, B; Wallace, AA; Sitko, GR; Cook, JJ; Holahan, MA; Stranieri-Michener, M; Leonard, YM; Lynch, JJ; McMasters, DR; Yan, Y 9-hydroxyazafluorenes and their use in thrombin inhibitors. J Med Chem48:2282-93 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM50164260 |
|---|
| n/a |
|---|
| Name | BDBM50164260 |
|---|
| Synonyms: | (S)-1-(7-Chloro-5-hydroxy-5H-indeno[1,2-b]pyridine-5-carbonyl)-pyrrolidine-2-carboxylic acid 2-aminomethyl-5-chloro-benzylamide | CHEMBL191441 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H24Cl2N4O3 |
|---|
| Mol. Mass. | 511.4 |
|---|
| SMILES | NCc1ccc(Cl)cc1CNC(=O)[C@@H]1CCCN1C(=O)C1(O)c2cc(Cl)ccc2-c2ncccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
