Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50410175
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302988
Ki 1.8±n/a nM
Citation Feng DMWai JMKuduk SDNg CMurphy KLRansom RWReiss DChang RSHarrell CMMacNeil TTang CPrueksaritanont TFreidinger RMPettibone DJBock MG 2,3-Diaminopyridine as a platform for designing structurally unique nonpeptide bradykinin B1 receptor antagonists. Bioorg Med Chem Lett 15:2385-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50410175
n/a
NameBDBM50410175
Synonyms:CHEMBL2113087
TypeSmall organic molecule
Emp. Form.C25H24F3N3O3
Mol. Mass.471.4716
SMILESCOC(=O)c1ccccc1-c1ccc(cc1)[C@@H](C)Nc1nccc(C)c1NC(=O)CC(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: