| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gonadotropin-releasing hormone receptor |
|---|
| Ligand | BDBM50166450 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_303284 (CHEMBL828277) |
|---|
| Ki | 0.64±n/a nM |
|---|
| Citation |  Guo, Z; Chen, Y; Huang, CQ; Gross, TD; Pontillo, J; Rowbottom, MW; Saunders, J; Struthers, S; Tucci, FC; Xie, Q; Wade, W; Zhu, YF; Wu, D; Chen, C Uracils as potent antagonists of the human gonadotropin-releasing hormone receptor without atropisomers. Bioorg Med Chem Lett15:2519-22 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gonadotropin-releasing hormone receptor |
|---|
| Name: | Gonadotropin-releasing hormone receptor |
|---|
| Synonyms: | GNRHR | GNRHR_HUMAN | GRHR | GnRH receptor | GnRH-R | Gonadotropin releasing hormone 1 (GnRHR1) | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37749.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30968 |
|---|
| Residue: | 328 |
|---|
| Sequence: | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
|
|
|
|---|
| BDBM50166450 |
|---|
| n/a |
|---|
| Name | BDBM50166450 |
|---|
| Synonyms: | (R)-1-(2-fluoro-6-(trifluoromethyl)benzyl)-3-(2-amino-2-phenylethyl)-5-(2-fluoro-3-methoxyphenyl)pyrimidine-2,4(1H,3H)-dione | (R)-3-(2-amino-2-phenylethyl)-5-(2-fluoro-3-methoxyphenyl)-1-(2-fluoro-6-(trifluoromethyl)benzyl)pyrimidine-2,4(1H,3H)-dione | 3-((R)-2-Amino-2-phenyl-ethyl)-5-(2-fluoro-3-methoxy-phenyl)-1-(2-fluoro-6-trifluoromethyl-benzyl)-1H-pyrimidine-2,4-dione | CHEMBL434936 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H22F5N3O3 |
|---|
| Mol. Mass. | 531.4739 |
|---|
| SMILES | COc1cccc(c1F)-c1cn(Cc2c(F)cccc2C(F)(F)F)c(=O)n(C[C@H](N)c2ccccc2)c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
