| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tryptase beta-2 |
|---|
| Ligand | BDBM50167525 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302629 (CHEMBL839921) |
|---|
| Ki | 57±n/a nM |
|---|
| Citation |  Hopkins, CR; Czekaj, M; Kaye, SS; Gao, Z; Pribish, J; Pauls, H; Liang, G; Sides, K; Cramer, D; Cairns, J; Luo, Y; Lim, HK; Vaz, R; Rebello, S; Maignan, S; Dupuy, A; Mathieu, M; Levell, J Design, synthesis, and biological activity of potent and selective inhibitors of mast cell tryptase. Bioorg Med Chem Lett15:2734-7 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tryptase beta-2 |
|---|
| Name: | Tryptase beta-2 |
|---|
| Synonyms: | TPS2 | TPSB2 | TRYB2_HUMAN | Tryptase | Tryptase II | Tryptase beta-1 | Tryptase-2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30518.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_210702 |
|---|
| Residue: | 275 |
|---|
| Sequence: | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
|
|
|
|---|
| BDBM50167525 |
|---|
| n/a |
|---|
| Name | BDBM50167525 |
|---|
| Synonyms: | CHEMBL193514 | [4-(3-Aminomethyl-phenyl)-piperidin-1-yl]-[1-(2-methoxy-ethyl)-1H-indol-3-yl]-methanone; TFA |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H29N3O2 |
|---|
| Mol. Mass. | 391.506 |
|---|
| SMILES | COCCn1cc(C(=O)N2CCC(CC2)c2cccc(CN)c2)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
