Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTryptase
LigandBDBM50167534
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302629
Ki 41±n/a nM
Citation Hopkins CRCzekaj MKaye SSGao ZPribish JPauls HLiang GSides KCramer DCairns JLuo YLim HKVaz RRebello SMaignan SDupuy AMathieu MLevell J Design, synthesis, and biological activity of potent and selective inhibitors of mast cell tryptase. Bioorg Med Chem Lett 15:2734-7 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tryptase
Name:Tryptase
Synonyms:Tryptase II | Tryptase beta-1 | Tryptase beta-2 | Tryptase-2
Type:PROTEIN
Mol. Mass.:30518.79
Organism:Homo sapiens (Human)
Description:ChEMBL_210702
Residue:275
Sequence:
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50167534
n/a
NameBDBM50167534
Synonyms:CHEMBL370284 | [4-(3-Aminomethyl-phenyl)-piperidin-1-yl]-(1-ethyl-7-methyl-1H-indol-3-yl)-methanone; TFA
TypeSmall organic molecule
Emp. Form.C24H29N3O
Mol. Mass.375.5066
SMILESCCn1cc(C(=O)N2CCC(CC2)c2cccc(CN)c2)c2cccc(C)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: