Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDipeptidyl peptidase VIII
LigandBDBM50168268
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304640
IC50 19±n/a nM
Citation Lu ILLee SJTsu HWu SYKao KHChien CHChang YYChen YSCheng JHChang CNChen TWChang SPChen XJiaang WT Glutamic acid analogues as potent dipeptidyl peptidase IV and 8 inhibitors. Bioorg Med Chem Lett 15:3271-5 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dipeptidyl peptidase VIII
Name:Dipeptidyl peptidase VIII
Synonyms:DPP8 | DPRP-1 | Dipeptidyl peptidase 8 (DPP-8) | Dipeptidyl peptidase 8 (DPP8) | Dipeptidyl peptidase IV-related protein 1 | Dipeptidyl peptidase VIII (DDP-VIII) | Prolyl dipeptidase DPP8
Type:Enzyme
Mol. Mass.:103342.62
Organism:Homo sapiens (Human)
Description:Q6V1X1
Residue:898
Sequence:
MWKRSEQMKIKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQ
LKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPK
TINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLF
QAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISN
IVTREERRLTYVHNELANMEEDARSAGVATFVLQEEFDRYSGYWWCPKAETTPSGGKILR
ILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMIDAEGRIIDVI
DKELIQPFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVEDDVM
ERQRLIESVPDSVTPLIIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLY
KITSILKESKYKRSSGGLPAPSDFKCPIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYF
EGTKDSPLEHHLYVVSYVNPGEVTRLTDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLY
KLSSPEDDPTCKTKEFWATILDSAGPLPDYTPPEIFSFESTTGFTLYGMLYKPHDLQPGK
KYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEGAFKY
KMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALMQRSDIFRVAIAGAP
VTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAH
TSILLSFLVRAGKPYDLQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKVI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50168268
n/a
NameBDBM50168268
Synonyms:(S)-1-[(S)-2-Amino-4-(6,7-dimethoxy-3,4-dihydro-1H-isoquinolin-2-yl)-4-oxo-butyryl]-pyrrolidine-2-carbonitrile | CHEMBL369883
TypeSmall organic molecule
Emp. Form.C20H26N4O4
Mol. Mass.386.4448
SMILESCOc1cc2CCN(Cc2cc1OC)C(=O)C[C@H](N)C(=O)N1CCC[C@H]1C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: