Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanin-concentrating hormone receptor 1
LigandBDBM50168509
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306753
IC50 3±n/a nM
Citation Vasudevan AVerzal MKWodka DSouers AJBlackburn CChe JLLai SBrodjian SFalls DHDayton BDGovek EDaniels TGeddes BMarsh KCHernandez LECollins CAKym PR Identification of aminopiperidine benzamides as MCHr1 antagonists. Bioorg Med Chem Lett 15:3412-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanin-concentrating hormone receptor 1
Name:Melanin-concentrating hormone receptor 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:46284.17
Organism:Mus musculus
Description:ChEMBL_818502
Residue:423
Sequence:
MSVGAGKEGVGRAVGLRGSRGCQAVEEDPFLDCGAQAPGQGGGGRWRLPQPAWVDGRALH
SREQATCTGCMDLQASLLSTGPNASNISDGQDNFTLAGPPPRTRSVSYINIIMPSVFGTI
CLLGIVGNSTVIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWH
FGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSMATLVICLLWAL
SFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVK
ILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFV
YLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTES
KGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50168509
n/a
NameBDBM50168509
Synonyms:CHEMBL188937 | N-(1-Benzo[1,3]dioxol-5-ylmethyl-piperidin-3-yl)-3,5-dimethoxy-4-methyl-benzamide
TypeSmall organic molecule
Emp. Form.C23H28N2O5
Mol. Mass.412.4788
SMILESCOc1cc(cc(OC)c1C)C(=O)NC1CCCN(Cc2ccc3OCOc3c2)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: