| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM50168766 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_304998 (CHEMBL829434) |
|---|
| IC50 | >1000±n/a nM |
|---|
| Citation |  Riendeau, D; Aspiotis, R; Ethier, D; Gareau, Y; Grimm, EL; Guay, J; Guiral, S; Juteau, H; Mancini, JA; Méthot, N; Rubin, J; Friesen, RW Inhibitors of the inducible microsomal prostaglandin E2 synthase (mPGES-1) derived from MK-886. Bioorg Med Chem Lett15:3352-5 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM50168766 |
|---|
| n/a |
|---|
| Name | BDBM50168766 |
|---|
| Synonyms: | 3-(1-(4-chlorobenzyl)-5-(2-fluoro-2'-methylbiphenyl-4-yl)-3-methyl-1H-indol-2-yl)-2,2-dimethylpropanoic acid | 3-[1-(4-Chloro-benzyl)-5-(2-fluoro-2'-methyl-biphenyl-4-yl)-3-methyl-1H-indol-2-yl]-2,2-dimethyl-propionic acid | CHEMBL180650 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H31ClFNO2 |
|---|
| Mol. Mass. | 540.067 |
|---|
| SMILES | Cc1c(CC(C)(C)C(O)=O)n(Cc2ccc(Cl)cc2)c2ccc(cc12)-c1ccc(c(F)c1)-c1ccccc1C |
|---|
| Structure | 
|
|---|
Search and Browse
