Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate receptor ionotropic, kainate 2
LigandBDBM50207594
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303287
Ki 13200±n/a nM
Citation Dominguez EIyengar SShannon HEBleakman DAlt AArnold BMBell MGBleisch TJBuckmaster JLCastano AMDel Prado MEscribano AFilla SAHo KHHudziak KJJones CKMartinez-Perez JAMateo AMathes BMMattiuz ELOgden AMSimmons RMStack DRStratford REWinter MAWu ZOrnstein PL Two prodrugs of potent and selective GluR5 kainate receptor antagonists actives in three animal models of pain. J Med Chem 48:4200-3 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate receptor ionotropic, kainate 2
Name:Glutamate receptor ionotropic, kainate 2
Synonyms:EAA4 | Excitatory amino acid receptor 4 | GLUR6 | GRIK2 | GluK2 | GluR-6 | Glutamate kainate | Glutamate receptor 6 | Glutamate receptor ionotropic kainate 2 | Glutamate receptor, ionotropic kainate 2 | Glutamate-Kainate | Glutamate-Kainate, GluR6
Type:Enzyme Catalytic Domain
Mol. Mass.:102592.78
Organism:Homo sapiens (Human)
Description:Q13002
Residue:908
Sequence:
MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50207594
n/a
NameBDBM50207594
Synonyms:2,3-Dihydroxy-6-nitro-benzo[f]quinoxaline-7-sulfonic acid amide | 2,3-dihydroxy-6-nitro-7-sulfamoyl-benzo(f)quinoxaline | 2,3-dihydroxy-6-nitro-7-sulfamoylbenzo(f)quinoxaline | 3-Hydroxy-6-nitro-7-sulfamoyl-benzo[f]quinoxalin-2-ol anion | 6-Nitro-2,3-dioxo-1,2,3,4,4a,10b-hexahydro-benzo[f]quinoxaline-7-sulfonic acid amide | 6-Nitro-2,3-dioxo-1,2,3,4-tetrahydro-benzo[f]quinoxaline-7-sulfinic acid amide | 6-Nitro-2,3-dioxo-1,2,3,4-tetrahydro-benzo[f]quinoxaline-7-sulfonic acid amide | 6-Nitro-2,3-dioxo-2,3-dihydro-benzo[f]quinoxaline-7-sulfonic acid amide | 6-nitro-2,3-dioxo-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide | CHEMBL222519
TypeSmall organic molecule
Emp. Form.C12H8N4O6S
Mol. Mass.336.28
SMILESNS(=O)(=O)c1cccc2c1c(cc1[nH]c(=O)c(=O)[nH]c21)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: