Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanin-concentrating hormone receptor
LigandBDBM50169388
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303523
Ki 2.2±n/a nM
Citation Guo TShao YQian GRokosz LLStauffer TMHunter RCBabu SDGu HHobbs DW Discovery and SAR of biaryl piperidine MCH1 receptor antagonists through solid-phase encoded combinatorial synthesis. Bioorg Med Chem Lett 15:3696-700 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanin-concentrating hormone receptor
Name:Melanin-concentrating hormone receptor
Synonyms:G-protein coupled receptor 24 | GPR24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCHR | MCHR-1 | Melanin Concentrating Hormone 1 | Melanin-Concentrating Hormone Receptor 1 (MCH1R) | Melanin-concentrating hormone receptor 1 (MCH-1) | Melanin-concentrating hormone receptor 1 (MCH1) | Melanin-concentrating hormone receptor 1 (MCHR-1) | Melanin-concentrating hormone receptor 1 (MCHR1) | SLC-1 | Somatostatin receptor-like protein
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45976.27
Organism:Homo sapiens (Human)
Description:Membranes from CHO-K1 cells stably expressing human MCH1R were used in assays.
Residue:422
Sequence:
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50169388
n/a
NameBDBM50169388
Synonyms:1-(3,5-Dichloro-phenyl)-3-[1-methanesulfonyl-4-(4-pyridin-3-yl-phenyl)-piperidin-4-ylmethyl]-urea | CHEMBL176079
TypeSmall organic molecule
Emp. Form.C25H26Cl2N4O3S
Mol. Mass.533.47
SMILESCS(=O)(=O)N1CCC(CNC(=O)Nc2cc(Cl)cc(Cl)c2)(CC1)c1ccc(cc1)-c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: