Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase A2 isozyme DE-I
LigandBDBM50148911
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305607
IC50 2900±n/a nM
Citation Khanum SAMurari SKVishwanth BSShashikanth S Synthesis of benzoyl phenyl benzoates as effective inhibitors for phospholipase A2 and hyaluronidase enzymes. Bioorg Med Chem Lett 15:4100-4 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase A2 isozyme DE-I
Name:Phospholipase A2 isozyme DE-I
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:13475.55
Organism:Naja melanoleuca
Description:ChEMBL_305607
Residue:118
Sequence:
NLYQFKNMIHCTVPNRPWWHFANYGCYCGRGGKGTPVDDLDRCCQIHDKCYDEAEKISGC
WPYIKTYTYESCQGTLTCKDGGKCAASVCDCDRVAANCFARATYNDKNYNIDFNARCQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148911
n/a
NameBDBM50148911
Synonyms:(3beta)-3-hydroxyurs-12-en-28-oic acid | 3beta-hydroxyurs-12-en-28-oic acid | CHEMBL169 | Ursolic acid | malol | prunol | urson
TypeSmall organic molecule
Emp. Form.C30H48O3
Mol. Mass.456.7003
SMILESC[C@@H]1CC[C@@]2(CC[C@]3(C)C(=CC[C@@H]4[C@@]5(C)CC[C@H](O)C(C)(C)[C@@H]5CC[C@@]34C)[C@@H]2[C@H]1C)C(O)=O |r,c:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: