| Reaction Details |
|---|
 | Report a problem with these data |
| Target | B1 bradykinin receptor |
|---|
| Ligand | BDBM50169823 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_302466 (CHEMBL826332) |
|---|
| Ki | 7.00±n/a nM |
|---|
| Citation |  Kuduk, SD; Chang, RK; Ng, C; Murphy, KL; Ransom, RW; Tang, C; Prueksaritanont, T; Freidinger, RM; Pettibone, DJ; Bock, MG Bradykinin B1 antagonists: SAR studies in the 2,3-diaminopyridine series. Bioorg Med Chem Lett15:3925-9 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| B1 bradykinin receptor |
|---|
| Name: | B1 bradykinin receptor |
|---|
| Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40508.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46663 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
|---|
| BDBM50169823 |
|---|
| n/a |
|---|
| Name | BDBM50169823 |
|---|
| Synonyms: | (+)-6-(4-{[3-(2-Cyano-acetylamino)-4-methyl-pyridin-2-ylamino]-methyl}-phenyl)-cyclohex-3-enecarboxylic acid methyl ester | (+/-cis)-6-(4-{[3-(2-Cyano-acetylamino)-4-methyl-pyridin-2-ylamino]-methyl}-phenyl)-cyclohex-3-enecarboxylic acid methyl ester | (+/-trans)-6-(4-{[3-(2-Cyano-acetylamino)-4-methyl-pyridin-2-ylamino]-methyl}-phenyl)-cyclohex-3-enecarboxylic acid methyl ester | (-)-6-(4-{[3-(2-Cyano-acetylamino)-4-methyl-pyridin-2-ylamino]-methyl}-phenyl)-cyclohex-3-enecarboxylic acid methyl ester | CHEMBL182378 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H26N4O3 |
|---|
| Mol. Mass. | 418.4882 |
|---|
| SMILES | COC(=O)C1CC=CCC1c1ccc(CNc2nccc(C)c2NC(=O)CC#N)cc1 |c:6| |
|---|
| Structure | 
|
|---|
Search and Browse
