| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50169897 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_305069 (CHEMBL832701) |
|---|
| IC50 | 1108±n/a nM |
|---|
| Citation |  Kuo, GH; Deangelis, A; Emanuel, S; Wang, A; Zhang, Y; Connolly, PJ; Chen, X; Gruninger, RH; Rugg, C; Fuentes-Pesquera, A; Middleton, SA; Jolliffe, L; Murray, WV Synthesis and identification of [1,3,5]triazine-pyridine biheteroaryl as a novel series of potent cyclin-dependent kinase inhibitors. J Med Chem48:4535-46 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50169897 |
|---|
| n/a |
|---|
| Name | BDBM50169897 |
|---|
| Synonyms: | 3-{4-[4-Amino-6-(3-chloro-phenylamino)-[1,3,5]triazin-2-yl]-pyridin-2-ylamino}-propan-1-ol | CHEMBL190805 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H18ClN7O |
|---|
| Mol. Mass. | 371.824 |
|---|
| SMILES | Nc1nc(Nc2cccc(Cl)c2)nc(n1)-c1ccnc(NCCCO)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
