Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVanilloid receptor
LigandBDBM20321
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302360
Ki 9.16±n/a nM
Citation Lee JKang SUKil MJShin MLim JOChoi HKJin MKKim SYKim SELee YSMin KHKim YHHa HJTran RWelter JDWang YSzabo TPearce LVLundberg DJToth APavlyukovets VAMorgan MABlumberg PM Analysis of structure-activity relationships for the 'A-region' of N-(4-t-butylbenzyl)-N'-[4-(methylsulfonylamino)benzyl]thiourea analogues as TRPV1 antagonists. Bioorg Med Chem Lett 15:4136-42 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vanilloid receptor
Name:Vanilloid receptor
Synonyms:Capsaicin receptor | OTRPC1 | Transient receptor potential cation channel subfamily V member 1 (TRPV1) | Vanilloid Receptor 1 (TRPV1, VR1) | Vanilloid VR1 | Vanilloid receptor 1 (VRI/TRPV1) | Vanilloid receptor type 1-like | Vanilloid receptor type 1-like (TrpV1/Vr1) | osm-9-like TRP channel 1
Type:Transient Receptor
Mol. Mass.:94956.12
Organism:Rattus norvegicus (rat)
Description:O35433
Residue:838
Sequence:
MEQRASLDSEESESPPQENSCLDPPDRDPNCKPPPVKPHIFTTRSRTRLFGKGDSEEASP
LDCPYEEGGLASCPIITVSSVLTIQRPGDGPASVRPSSQDSVSAGEKPPRLYDRRSIFDA
VAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVA
RKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTK
GRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTVD
NTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIHEP
ECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPNRHDMLLVEPLNR
LLQDKWDRFVKRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVGDYFRVTGEIL
SVSGGVYFFFRGIQYFLQRRPSLKSLFVDSYSEILFFVQSLFMLVSVVLYFSQRKEYVAS
MVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIE
DGKNNSLPMESTPHKCRGSACKPGNSYNSLYSTCLELFKFTIGMGDLEFTENYDFKAVFI
ILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAF
RSGKLLQVGFTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVKRTLSFSLRSG
RVSGRNWKNFALVPLLRDASTRDRHATQQEEVQLKHYTGSLKPEDAEVFKDSMVPGEK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20321
n/a
NameBDBM20321
Synonyms:3-[(4-tert-butylphenyl)methyl]-1-[(3-fluoro-4-methanesulfonamidophenyl)methyl]thiourea | CHEMBL388824 | JYL1421 | thiourea analogue, 2
TypeSmall organic molecule
Emp. Form.C20H26FN3O2S2
Mol. Mass.423.568
SMILESCC(C)(C)c1ccc(CNC(=S)NCc2ccc(NS(C)(=O)=O)c(F)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: