Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid TP receptor
LigandBDBM50171474
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303672
Ki 78±n/a nM
Citation Ohno MMiyamoto MHoshi KTakeda TYamada NOhtake A Development of dual-acting benzofurans for thromboxane A2 receptor antagonist and prostacyclin receptor agonist: synthesis, structure-activity relationship, and evaluation of benzofuran derivatives. J Med Chem 48:5279-94 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid TP receptor
Name:Thromboxane A2 receptor
Synonyms:TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta
Type:Enyzme
Mol. Mass.:37445.28
Organism:Homo sapiens (Human)
Description:P21731
Residue:343
Sequence:
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50171474
n/a
NameBDBM50171474
Synonyms:CHEMBL192662 | [3-[2-(1,1-Diphenyl-ethylsulfanyl)-ethyl]-2-(2-hydroxy-ethyl)-benzofuran-7-yloxy]-acetic acid
TypeSmall organic molecule
Emp. Form.C28H28O5S
Mol. Mass.476.584
SMILESCC(SCCc1c(CCO)oc2c(OCC(O)=O)cccc12)(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: