| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 3 |
|---|
| Ligand | BDBM23163 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_304343 (CHEMBL839769) |
|---|
| pH | 7.4±n/a |
|---|
| EC50 | 1.4±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Albert, R; Hinterding, K; Brinkmann, V; Guerini, D; Müller-Hartwieg, C; Knecht, H; Simeon, C; Streiff, M; Wagner, T; Welzenbach, K; Zécri, F; Zollinger, M; Cooke, N; Francotte, E Novel immunomodulator FTY720 is phosphorylated in rats and humans to form a single stereoisomer. Identification, chemical proof, and biological characterization of the biologically active species and its enantiomer. J Med Chem48:5373-7 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 3 |
|---|
| Name: | Sphingosine 1-phosphate receptor 3 |
|---|
| Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 42278.13 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99500 |
|---|
| Residue: | 378 |
|---|
| Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
|---|
| BDBM23163 |
|---|
| n/a |
|---|
| Name | BDBM23163 |
|---|
| Synonyms: | CHEMBL114606 | FTY720-phosphate, rac-2 | {2-amino-3-hydroxy-2-[2-(4-octylphenyl)ethyl]propoxy}phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H34NO5P |
|---|
| Mol. Mass. | 387.4507 |
|---|
| SMILES | CCCCCCCCc1ccc(CCC(N)(CO)COP(O)(O)=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
