Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50172914 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_321533 (CHEMBL880593) |
---|
IC50 | 0.9±n/a nM |
---|
Citation | Charton, J; Cazenave Gassiot, A; Girault-Mizzi, S; Debreu-Fontaine, MA; Melnyk, P; Sergheraert, C Synthesis and pharmacological evaluation of Tic-hydantoin derivatives as selective sigma1 ligands. Part 1. Bioorg Med Chem Lett15:4833-7 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50172914 |
---|
n/a |
---|
Name | BDBM50172914 |
Synonyms: | (S)-2-(2-Piperidin-1-yl-ethyl)-3-thioxo-2,3,10,10a-tetrahydro-5H-imidazo[1,5-b]isoquinolin-1-one | CHEMBL193805 |
Type | Small organic molecule |
Emp. Form. | C18H23N3OS |
Mol. Mass. | 329.46 |
SMILES | Oc1c2Cc3ccccc3Cn2c(=S)n1CCN1CCCCC1 |
Structure |
|