Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProteinase-activated receptor 1
LigandBDBM50173417
Substrate/Competitorn/a
Meas. Tech.ChEMBL_320796
Ki 12±n/a nM
Citation Chackalamannil SXia YGreenlee WJClasby MDoller DTsai HAsberom TCzarniecki MAhn HSBoykow GFoster CAgans-Fantuzzi JBryant MLau JChintala M Discovery of potent orally active thrombin receptor (protease activated receptor 1) antagonists as novel antithrombotic agents. J Med Chem 48:5884-7 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proteinase-activated receptor 1
Name:Proteinase-activated receptor 1
Synonyms:Coagulation factor II receptor | PAR-1 | Proteinase activated receptor 1 | Proteinase-activated receptor 1 (PAR-1) | Thrombin receptor | Thrombin receptor/ Proteinase-activated receptor 1(Par-1)
Type:Protein
Mol. Mass.:47450.07
Organism:Homo sapiens (Human)
Description:P25116
Residue:425
Sequence:
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173417
n/a
NameBDBM50173417
Synonyms:(3R,3aS,4S,4aR,8aS,9aR)-4-(2-(6-ethylpyridin-2-yl)vinyl)-3-methyl-decahydronaphtho[2,3-c]furan-1(3H)-one | (3R,3aS,4S,4aR,8aS,9aR)-4-[(E)-2-(6-Ethyl-pyridin-2-yl)-vinyl]-3-methyl-decahydro-naphtho[2,3-c]furan-1-one | CHEMBL197791
TypeSmall organic molecule
Emp. Form.C22H29NO2
Mol. Mass.339.4712
SMILESCCc1cccc(\C=C\[C@@H]2[C@@H]3[C@@H](C)OC(=O)[C@@H]3C[C@@H]3CCCC[C@@H]23)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: