Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanin-concentrating hormone receptor
LigandBDBM50173461
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321503
IC50 2±n/a nM
Citation Kym PRIyengar RSouers AJLynch JKJudd ASGao JFreeman JMulhern MZhao GVasudevan AWodka DBlackburn CBrown JChe JLCullis CLai SJLaMarche MJMarsilje TRoses JSells TGeddes BGovek EPatane MFry DDayton BDBrodjian SFalls DBrune MBush EShapiro RKnourek-Segel VFey TMcDowell CReinhart GAPreusser LCMarsh KHernandez LSham HLCollins CA Discovery and characterization of aminopiperidinecoumarin melanin concentrating hormone receptor 1 antagonists. J Med Chem 48:5888-91 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanin-concentrating hormone receptor
Name:Melanin-concentrating hormone receptor
Synonyms:G-protein coupled receptor 24 | GPR24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCHR | MCHR-1 | Melanin Concentrating Hormone 1 | Melanin-Concentrating Hormone Receptor 1 (MCH1R) | Melanin-concentrating hormone receptor 1 (MCH-1) | Melanin-concentrating hormone receptor 1 (MCH1) | Melanin-concentrating hormone receptor 1 (MCHR-1) | Melanin-concentrating hormone receptor 1 (MCHR1) | SLC-1 | Somatostatin receptor-like protein
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45976.27
Organism:Homo sapiens (Human)
Description:Membranes from CHO-K1 cells stably expressing human MCH1R were used in assays.
Residue:422
Sequence:
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173461
n/a
NameBDBM50173461
Synonyms:4-(1-Benzo[1,3]dioxol-5-ylmethyl-piperidin-4-ylamino)-6-chloro-chromen-2-one | CHEMBL194564
TypeSmall organic molecule
Emp. Form.C22H21ClN2O4
Mol. Mass.412.866
SMILESClc1ccc2oc(=O)cc(NC3CCN(Cc4ccc5OCOc5c4)CC3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: