Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase kinase kinase 8
LigandBDBM50173850
Substrate/Competitorn/a
Meas. Tech.ChEMBL_326807
IC50 73±n/a nM
Citation Gavrin LKGreen NHu YJanz KKaila NLi HQTam SYThomason JRGopalsamy ACiszewski GCuozzo JWHall JPHsu STelliez JBLin LL Inhibition of Tpl2 kinase and TNF-alpha production with 1,7-naphthyridine-3-carbonitriles: synthesis and structure-activity relationships. Bioorg Med Chem Lett 15:5288-92 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase kinase kinase 8
Name:Mitogen-activated protein kinase kinase kinase 8
Synonyms:C-COT | COT proto-oncogene serine/threonine-protein kinase | Cancer Osaka thyroid oncogene | Mitogen-activated protein kinase kinase kinase 8 | Tpl-2 | Tumor Progression Loci-2 Kinase (COT) | Tumor progression locus 2
Type:Serine/threonine-protein kinase
Mol. Mass.:52916.89
Organism:Homo sapiens (Human)
Description:n/a
Residue:467
Sequence:
MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERS
KSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGR
YQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVE
IQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPG
MRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELP
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173850
n/a
NameBDBM50173850
Synonyms:6-(benzylamino)-4-(3-chloro-4-fluorophenylamino)-1,7-naphthyridine-3-carbonitrile | CHEMBL200247
TypeSmall organic molecule
Emp. Form.C22H15ClFN5
Mol. Mass.403.839
SMILESFc1ccc(Nc2c(cnc3cnc(NCc4ccccc4)cc23)C#N)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: