Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnoyl-acyl-carrier protein reductase
LigandBDBM50174768
Substrate/Competitorn/a
Meas. Tech.ChEMBL_326719
IC50 220±n/a nM
Citation Freundlich JSAnderson JWSarantakis DShieh HMYu MValderramos JCLucumi EKuo MJacobs WRFidock DASchiehser GAJacobus DPSacchettini JC Synthesis, biological activity, and X-ray crystal structural analysis of diaryl ether inhibitors of malarial enoyl acyl carrier protein reductase. Part 1: 4'-substituted triclosan derivatives. Bioorg Med Chem Lett 15:5247-52 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Enoyl-acyl-carrier protein reductase
Name:Enoyl-acyl-carrier protein reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:49770.86
Organism:Plasmodium falciparum
Description:ChEMBL_795989
Residue:432
Sequence:
MNKISQRLLFLFLHFYTTVCFIQNNTQKTFHNVLQNEQIRGKEKAFYRKEKRENIFIGNK
MKHVHNMNNTHNNNHYMEKEEQDASNINKIKEENKNEDICFIAGIGDTNGYGWGIAKELS
KRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDKDKKMNILDMLPFDASFDTANDIDEE
TKNNKRYNMLQNYPIEDVANLIHQKYGKINMLVHSLANAKEVQKDLLNTSRKGYLDALSK
SSYSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLG
RNYNIRINTISAGPLKSRAATAINKLNNTYENNTNQNKNRNSHDVHNIMNNSGEKEEKKN
SASQNYTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIM
FLPDDIYRNENE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50174768
n/a
NameBDBM50174768
Synonyms:5‐chloro‐2‐(2‐chloro‐4‐hydroxyphenoxy)phenol (5) | 5-chloro-2-(2-chloro-4-hydroxyphenoxy)phenol | CHEMBL200379
TypeSmall organic molecule
Emp. Form.C12H8Cl2O3
Mol. Mass.271.096
SMILESOc1ccc(Oc2ccc(Cl)cc2O)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: