| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1B |
|---|
| Ligand | BDBM50175480 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_326566 (CHEMBL859777) |
|---|
| Ki | 1.7±n/a nM |
|---|
| Citation |  Kling, A; Lange, UE; Mack, H; Bakker, MH; Drescher, KU; Hornberger, W; Hutchins, CW; Möller, A; Müller, R; Schmidt, M; Unger, L; Wicke, K; Schellhaas, K; Steiner, G Synthesis and SAR of highly potent dual 5-HT1A and 5-HT1B antagonists as potential antidepressant drugs. Bioorg Med Chem Lett15:5567-73 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1B |
|---|
| Name: | 5-hydroxytryptamine receptor 1B |
|---|
| Synonyms: | 5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | 5HT1B_HUMAN | HTR1B | HTR1DB | S12 | Serotonin (5-HT) receptor | Serotonin 1D beta receptor | Serotonin Receptor 1B |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 43579.17 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells |
|---|
| Residue: | 390 |
|---|
| Sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
|
|
|
|---|
| BDBM50175480 |
|---|
| n/a |
|---|
| Name | BDBM50175480 |
|---|
| Synonyms: | 7-methyl-3-[2-(4-quinolin-5-yl-piperazin-1-yl)-ethyl]-5,6,7,8-tetrahydro-3H-pyrido[4',3':4,5]thieno[2,3-d]pyrimidin-4-one | CHEMBL197240 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H28N6OS |
|---|
| Mol. Mass. | 460.594 |
|---|
| SMILES | CN1CCc2c(C1)sc1ncn(CCN3CCN(CC3)c3cccc4ncccc34)c(=O)c21 |
|---|
| Structure | 
|
|---|
Search and Browse
